SCOPe 2.05: Domain d4ceua_: 4ceu A:

Lineage for d4ceua_ (4ceu A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries)

8. Domain d4ceua_: 4ceu A: [259175]
   Other proteins in same PDB: d4ceub_, d4ceuc1, d4ceuc2
   automated match to d4ubpa_
   complexed with edo, ni, oh, so4

Details for d4ceua_

PDB Entry: 4ceu, 1.58 Å

PDB Description: 1.58 a resolution native sporosarcina pasteurii urease

PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d4ceua_:

Sequence; same for both SEQRES and ATOM records:

>d4ceua_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d4ceua_:

• d4ceua_ first appeared in SCOPe 2.04
  
• d4ceua_ appears in SCOPe 2.06
  
• d4ceua_ appears in the current release, SCOPe 2.08