SCOPe 2.07: Domain d4lylh_: 4lyl H:

Lineage for d4lylh_ (4lyl H:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)

8. Domain d4lylh_: 4lyl H: [258928]
   Other proteins in same PDB: d4lyla1, d4lyla2, d4lylc1, d4lylc2, d4lyle1, d4lyle2, d4lylg1, d4lylg2, d4lyli1, d4lyli2, d4lylk1, d4lylk2, d4lylm1, d4lylm2, d4lylo1, d4lylo2
   automated match to d1ugia_
   protein/DNA complex

Details for d4lylh_

PDB Entry: 4lyl, 1.93 Å

PDB Description: Crystal structure of uracil-DNA glycosylase from cod (Gadus morhua) in complex with the proteinaceous inhibitor UGI

PDB Compounds: (H:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d4lylh_:

Sequence; same for both SEQRES and ATOM records:

>d4lylh_ d.17.5.1 (H:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

Timeline for d4lylh_:

• d4lylh_ first appeared in SCOPe 2.04
  
• d4lylh_ appears in SCOPe 2.06
  
• d4lylh_ appears in the current release, SCOPe 2.08