![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() has an additional strand at the C-terminus and a helix inserted after the first strand |
![]() | Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
![]() | Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species) |
![]() | Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries) |
![]() | Domain d4lyll_: 4lyl L: [258936] Other proteins in same PDB: d4lyla1, d4lyla2, d4lylc1, d4lylc2, d4lyle1, d4lyle2, d4lylg1, d4lylg2, d4lyli1, d4lyli2, d4lylk1, d4lylk2, d4lylm1, d4lylm2, d4lylo1, d4lylo2 automated match to d1ugia_ protein/DNA complex |
PDB Entry: 4lyl (more details), 1.93 Å
SCOPe Domain Sequences for d4lyll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lyll_ d.17.5.1 (L:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda peykpwalviqdsngenkikml
Timeline for d4lyll_: