Lineage for d4tx9a_ (4tx9 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566370Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1566403Protein automated matches [190186] (7 species)
    not a true protein
  7. 1566422Species Streptomyces sviceus [TaxId:463191] [258540] (2 PDB entries)
  8. 1566424Domain d4tx9a_: 4tx9 A: [258830]
    automated match to d2vepa_
    complexed with amz, so4

Details for d4tx9a_

PDB Entry: 4tx9 (more details), 1.6 Å

PDB Description: crystal structure of hisap from streptomyces sviceus with degraded profar
PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d4tx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tx9a_ c.1.2.1 (A:) automated matches {Streptomyces sviceus [TaxId: 463191]}
ampsklsrlellpavdvrdgqavrlvhgesgtetsygspleaalswqragaewlhlvdld
aafgtgdnrelvrqvteamdikvelsggirddaslaaalatgctrvnlgtaalespewva
kviaehgdriavgldvrgttlkgrgwtseggdlyealerldkegcaryvvtdiakdgtlq
gpnlellrnvcaatdrpvvasggvsslddlraiaelvplgvegsivgkalyakaftleea
leavaq

SCOPe Domain Coordinates for d4tx9a_:

Click to download the PDB-style file with coordinates for d4tx9a_.
(The format of our PDB-style files is described here.)

Timeline for d4tx9a_: