SCOPe 2.05: Domain d4tx9a_: 4tx9 A:

Lineage for d4tx9a_ (4tx9 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein automated matches [190186] (9 species)
   not a true protein

7. Species Streptomyces sviceus [TaxId:463191] [258540] (2 PDB entries)

8. Domain d4tx9a_: 4tx9 A: [258830]
   automated match to d2vepa_
   complexed with amz, so4

Details for d4tx9a_

PDB Entry: 4tx9, 1.6 Å

PDB Description: crystal structure of hisap from streptomyces sviceus with degraded profar

PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d4tx9a_:

Sequence; same for both SEQRES and ATOM records:

>d4tx9a_ c.1.2.1 (A:) automated matches {Streptomyces sviceus [TaxId: 463191]}
ampsklsrlellpavdvrdgqavrlvhgesgtetsygspleaalswqragaewlhlvdld
aafgtgdnrelvrqvteamdikvelsggirddaslaaalatgctrvnlgtaalespewva
kviaehgdriavgldvrgttlkgrgwtseggdlyealerldkegcaryvvtdiakdgtlq
gpnlellrnvcaatdrpvvasggvsslddlraiaelvplgvegsivgkalyakaftleea
leavaq

Timeline for d4tx9a_:

• d4tx9a_ first appeared in SCOPe 2.04
  
• d4tx9a_ is called d4tx9a1 in SCOPe 2.06
  
• d4tx9a_ appears in the current release, SCOPe 2.08, called d4tx9a1