SCOPe 2.08: Domain d1btpa_: 1btp A:

Lineage for d1btpa_ (1btp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
   Uniprot P00760

8. Domain d1btpa_: 1btp A: [25878]
   complexed with ca

Details for d1btpa_

PDB Entry: 1btp, 2.2 Å

PDB Description: unique binding of a novel synthetic inhibitor, n-[3-[4-[4-(amidinophenoxy)-carbonyl]phenyl]-2-methyl-2-propenoyl]-n-allylglycine methanesulfonate to bovine trypsin, revealed by the crystal structure of the complex

PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1btpa_:

Sequence; same for both SEQRES and ATOM records:

>d1btpa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1btpa_:

• d1btpa_ first appeared (with stable ids) in SCOP 1.55, called d1btp__
  
• d1btpa_ appears in SCOPe 2.07