PDB entry 1btp

View 1btp on RCSB PDB site
Description: unique binding of a novel synthetic inhibitor, n-[3-[4-[4-(amidinophenoxy)-carbonyl]phenyl]-2-methyl-2-propenoyl]-n-allylglycine methanesulfonate to bovine trypsin, revealed by the crystal structure of the complex
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1995-08-11, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btpa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1btpA (A:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btpA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn