Lineage for d4om7a_ (4om7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115398Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 2115399Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins)
    automatically mapped to Pfam PF01582
  6. 2115412Protein automated matches [226912] (1 species)
    not a true protein
  7. 2115413Species Human (Homo sapiens) [TaxId:9606] [225149] (2 PDB entries)
  8. 2115416Domain d4om7a_: 4om7 A: [258695]
    automated match to d2j67b_

Details for d4om7a_

PDB Entry: 4om7 (more details), 2.2 Å

PDB Description: crystal structure of tir domain of tlr6
PDB Compounds: (A:) Toll-like receptor 6

SCOPe Domain Sequences for d4om7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4om7a_ c.23.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqfhafisysehdsawvkselvpylekediqiclhernfvpgksiveniincieksyksi
fvlspnfvqsewchyelyfahhnlfhegsnnlilillepipqnsipnkyhklkalmtqrt
ylqwpkekskrglfwaniraafn

SCOPe Domain Coordinates for d4om7a_:

Click to download the PDB-style file with coordinates for d4om7a_.
(The format of our PDB-style files is described here.)

Timeline for d4om7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4om7b_