Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) |
Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins) automatically mapped to Pfam PF01582 |
Protein automated matches [226912] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225149] (2 PDB entries) |
Domain d4om7a_: 4om7 A: [258695] automated match to d2j67b_ |
PDB Entry: 4om7 (more details), 2.2 Å
SCOPe Domain Sequences for d4om7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4om7a_ c.23.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqfhafisysehdsawvkselvpylekediqiclhernfvpgksiveniincieksyksi fvlspnfvqsewchyelyfahhnlfhegsnnlilillepipqnsipnkyhklkalmtqrt ylqwpkekskrglfwaniraafn
Timeline for d4om7a_: