SCOPe 2.08: Domain d4pquc2: 4pqu C:430-545

Lineage for d4pquc2 (4pqu C:430-545)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)

8. Domain d4pquc2: 4pqu C:430-545 [258230]
   Other proteins in same PDB: d4pqua1, d4pqub_, d4pquc1, d4pqud_
   automated match to d2ykna2
   protein/DNA complex; protein/RNA complex; complexed with dtp, edo, gol, mg, so4

Details for d4pquc2

PDB Entry: 4pqu, 2.51 Å

PDB Description: Crystal structure of HIV-1 Reverse Transcriptase in complex with RNA/DNA and dATP

PDB Compounds: (C:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4pquc2:

Sequence; same for both SEQRES and ATOM records:

>d4pquc2 c.55.3.0 (C:430-545) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtnsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggn

Timeline for d4pquc2:

• d4pquc2 first appeared in SCOPe 2.04
  
• d4pquc2 appears in SCOPe 2.07