Lineage for d4pqua2 (4pqu A:430-545)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887412Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)
  8. 2887425Domain d4pqua2: 4pqu A:430-545 [257525]
    Other proteins in same PDB: d4pqua1, d4pqub_, d4pquc1, d4pqud_
    automated match to d2ykna2
    protein/DNA complex; protein/RNA complex; complexed with dtp, edo, gol, mg, so4

Details for d4pqua2

PDB Entry: 4pqu (more details), 2.51 Å

PDB Description: Crystal structure of HIV-1 Reverse Transcriptase in complex with RNA/DNA and dATP
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4pqua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pqua2 c.55.3.0 (A:430-545) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtnsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggn

SCOPe Domain Coordinates for d4pqua2:

Click to download the PDB-style file with coordinates for d4pqua2.
(The format of our PDB-style files is described here.)

Timeline for d4pqua2: