SCOP 1.63: Domain d5sgae_: 5sga E:

Lineage for d5sgae_ (5sga E:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)

6. Protein Protease A [50500] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)

8. Domain d5sgae_: 5sga E: [25812]

Details for d5sgae_

PDB Entry: 5sga, 1.8 Å

PDB Description: Structures of product and inhibitor complexes of Streptomyces griseus protease a at 1.8 Angstroms resolution. a model for serine protease catalysis

SCOP Domain Sequences for d5sgae_:

Sequence; same for both SEQRES and ATOM records:

>d5sgae_ b.47.1.1 (E:) Protease A {Streptomyces griseus, strain k1}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

Timeline for d5sgae_:

• d5sgae_ first appeared (with stable ids) in SCOP 1.55
  
• d5sgae_ appears in SCOP 1.61
  
• d5sgae_ appears in SCOP 1.65
  
• d5sgae_ appears in the current release, SCOPe 2.08