Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein Protease A [50500] (1 species) |
Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries) |
Domain d2sgaa_: 2sga A: [25808] |
PDB Entry: 2sga (more details), 1.5 Å
SCOPe Domain Sequences for d2sgaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv l
Timeline for d2sgaa_: