SCOPe 2.07: Domain d2sgaa_: 2sga A:

Lineage for d2sgaa_ (2sga A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Protease A [50500] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)

8. Domain d2sgaa_: 2sga A: [25808]

Details for d2sgaa_

PDB Entry: 2sga, 1.5 Å

PDB Description: electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution

PDB Compounds: (A:) proteinase a

SCOPe Domain Sequences for d2sgaa_:

Sequence; same for both SEQRES and ATOM records:

>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

Timeline for d2sgaa_:

• d2sgaa_ first appeared (with stable ids) in SCOP 1.55, called d2sga__
  
• d2sgaa_ appears in SCOPe 2.06
  
• d2sgaa_ appears in the current release, SCOPe 2.08