Lineage for d2sga__ (2sga -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins) 
Protein Protease A [50500] (1 species) Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries) 
Domain d2sga__: 2sga - [25808]
Details for d2sga__
PDB Entry: 2sga (more details), 1.5 Å
PDB Description: electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
SCOP Domain Sequences for d2sga__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sga__ b.47.1.1 (-) Protease A {Streptomyces griseus, strain k1}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l
SCOP Domain Coordinates for d2sga__:
Click to download the PDB-style file with coordinates for d2sga__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sga__:
- d2sga__ appears in SCOP 1.57
- d2sga__ appears in the current release, SCOPe 2.08, called d2sgaa_
View in 3D