SCOPe 2.05: Domain d4ozru_: 4ozr U:

Lineage for d4ozru_ (4ozr U:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Pediculus humanus [TaxId:121224] [258056] (2 PDB entries)

8. Domain d4ozru_: 4ozr U: [258063]
   automated match to d3nsqa_

Details for d4ozru_

PDB Entry: 4ozr, 2.7 Å

PDB Description: Crystal structure of the ligand binding domains of the Bovicola ovis ecdysone receptor EcR/USP heterodimer (methylene lactam crystal)

PDB Compounds: (U:) retinoid x receptor

SCOPe Domain Sequences for d4ozru_:

Sequence; same for both SEQRES and ATOM records:

>d4ozru_ a.123.1.1 (U:) automated matches {Pediculus humanus [TaxId: 121224]}
aanavanicqatntqlyqlvewakhiphfsslpiedqvlllragwnelliaafshrsvev
rdgivlgagitvhrnsahqagvgtifdrvltelvakmrdmnmdrtelgslrsiilfnpev
rglksgqevellrekvyaaleeytrvtrpeepgrfaklllrlpalrsiglkclehlfffr
ligdipidtflmdmlg

Timeline for d4ozru_:

• d4ozru_ first appeared in SCOPe 2.04
  
• d4ozru_ appears in SCOPe 2.06
  
• d4ozru_ appears in the current release, SCOPe 2.08