Lineage for d4ozru_ (4ozr U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729941Species Pediculus humanus [TaxId:121224] [258056] (2 PDB entries)
  8. 2729944Domain d4ozru_: 4ozr U: [258063]
    automated match to d3nsqa_

Details for d4ozru_

PDB Entry: 4ozr (more details), 2.7 Å

PDB Description: Crystal structure of the ligand binding domains of the Bovicola ovis ecdysone receptor EcR/USP heterodimer (methylene lactam crystal)
PDB Compounds: (U:) retinoid x receptor

SCOPe Domain Sequences for d4ozru_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozru_ a.123.1.1 (U:) automated matches {Pediculus humanus [TaxId: 121224]}
aanavanicqatntqlyqlvewakhiphfsslpiedqvlllragwnelliaafshrsvev
rdgivlgagitvhrnsahqagvgtifdrvltelvakmrdmnmdrtelgslrsiilfnpev
rglksgqevellrekvyaaleeytrvtrpeepgrfaklllrlpalrsiglkclehlfffr
ligdipidtflmdmlg

SCOPe Domain Coordinates for d4ozru_:

Click to download the PDB-style file with coordinates for d4ozru_.
(The format of our PDB-style files is described here.)

Timeline for d4ozru_: