Lineage for d4ozte_ (4ozt E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342991Species Pediculus humanus [TaxId:121224] [258056] (2 PDB entries)
  8. 2342992Domain d4ozte_: 4ozt E: [258057]
    automated match to d3ixpd_
    complexed with neq, p1a

Details for d4ozte_

PDB Entry: 4ozt (more details), 2.7 Å

PDB Description: crystal structure of the ligand binding domains of the Bovicola ovis ecdysone receptor EcR/USP heterodimer (PonA crystal)
PDB Compounds: (E:) Ecdysone receptor

SCOPe Domain Sequences for d4ozte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozte_ a.123.1.1 (E:) automated matches {Pediculus humanus [TaxId: 121224]}
vkpispeqeelihrlvyfqneyeqpsdedlkrisntpsegedqsdlnfrhiteitiltvq
livefakrlpgfdkllredqiallkacssevmmlrmarrydvgsdsilfannqpytrdsy
slagmgetvddllrfcrqmygmkvdnaeyalltaivifserpsliegwkvekiqeiylea
lkvyvdnrrkpasgtifakllsvltelrtlgnlnsemcfslklknkklppflaeiwdv

SCOPe Domain Coordinates for d4ozte_:

Click to download the PDB-style file with coordinates for d4ozte_.
(The format of our PDB-style files is described here.)

Timeline for d4ozte_: