SCOPe 2.08: Domain d4ozte_: 4ozt E:

Lineage for d4ozte_ (4ozt E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Pediculus humanus [TaxId:121224] [258056] (2 PDB entries)

8. Domain d4ozte_: 4ozt E: [258057]
   automated match to d3ixpd_
   complexed with neq, p1a

Details for d4ozte_

PDB Entry: 4ozt, 2.7 Å

PDB Description: crystal structure of the ligand binding domains of the Bovicola ovis ecdysone receptor EcR/USP heterodimer (PonA crystal)

PDB Compounds: (E:) Ecdysone receptor

SCOPe Domain Sequences for d4ozte_:

Sequence; same for both SEQRES and ATOM records:

>d4ozte_ a.123.1.1 (E:) automated matches {Pediculus humanus [TaxId: 121224]}
vkpispeqeelihrlvyfqneyeqpsdedlkrisntpsegedqsdlnfrhiteitiltvq
livefakrlpgfdkllredqiallkacssevmmlrmarrydvgsdsilfannqpytrdsy
slagmgetvddllrfcrqmygmkvdnaeyalltaivifserpsliegwkvekiqeiylea
lkvyvdnrrkpasgtifakllsvltelrtlgnlnsemcfslklknkklppflaeiwdv

Timeline for d4ozte_:

• d4ozte_ first appeared in SCOPe 2.04
  
• d4ozte_ appears in SCOPe 2.07