Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein alpha-Lytic protease [50498] (1 species) |
Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (46 PDB entries) |
Domain d1gbda_: 1gbd A: [25787] complexed with so4 |
PDB Entry: 1gbd (more details), 2.2 Å
SCOPe Domain Sequences for d1gbda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gbda_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt anyaegavrgltqgnacagrgdsggswitsagqaqgvmsganvqsngnncgipasqrssl ferlqpilsqyglslvtg
Timeline for d1gbda_: