SCOPe 2.07: Domain d2ky3a1: 2ky3 A:3-33

Lineage for d2ky3a1 (2ky3 A:3-33)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein automated matches [197331] (11 species)
   not a true protein

7. Species Mesobuthus tamulus [TaxId:34647] [255376] (18 PDB entries)

8. Domain d2ky3a1: 2ky3 A:3-33 [257819]
   Other proteins in same PDB: d2ky3a2
   automated match to d1scya_

Details for d2ky3a1

PDB Entry: 2ky3

PDB Description: solution structure of gs-alfa-ktx5.4 synthetic scorpion like

PDB Compounds: (A:) Potassium channel toxin alpha-KTx 5.4

SCOPe Domain Sequences for d2ky3a1:

Sequence; same for both SEQRES and ATOM records:

>d2ky3a1 g.3.7.2 (A:3-33) automated matches {Mesobuthus tamulus [TaxId: 34647]}
afcnlrrcelscrslgllgkcigeeckcvpy

Timeline for d2ky3a1:

• d2ky3a1 first appeared in SCOPe 2.04, called d2ky3a_
  
• d2ky3a1 appears in SCOPe 2.06
  
• d2ky3a1 appears in the current release, SCOPe 2.08