Lineage for d4cvja1 (4cvj A:4-294)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333414Protein automated matches [190089] (9 species)
    not a true protein
  7. 2333415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (24 PDB entries)
  8. 2333439Domain d4cvja1: 4cvj A:4-294 [257760]
    Other proteins in same PDB: d4cvja2
    automated match to d2xj5a_
    complexed with dod, hem

Details for d4cvja1

PDB Entry: 4cvj (more details), 2.18 Å

PDB Description: neutron structure of compound i intermediate of cytochrome c peroxidase - deuterium exchanged 100 k
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4cvja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvja1 a.93.1.1 (A:4-294) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4cvja1:

Click to download the PDB-style file with coordinates for d4cvja1.
(The format of our PDB-style files is described here.)

Timeline for d4cvja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cvja2