Lineage for d4cvja_ (4cvj A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497288Protein automated matches [190089] (7 species)
    not a true protein
  7. 1497289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (25 PDB entries)
  8. 1497314Domain d4cvja_: 4cvj A: [257760]
    automated match to d2xj5a_
    complexed with dod, hem

Details for d4cvja_

PDB Entry: 4cvj (more details), 2.5 Å

PDB Description: neutron structure of compound i intermediate of cytochrome c peroxidase - deuterium exchanged 100 k
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4cvja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvja_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4cvja_:

Click to download the PDB-style file with coordinates for d4cvja_.
(The format of our PDB-style files is described here.)

Timeline for d4cvja_: