SCOP 1.73: Domain d1arca_: 1arc A:

Lineage for d1arca_ (1arc A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)

6. Protein Achromobacter protease [50496] (1 species)

7. Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (2 PDB entries)

8. Domain d1arca_: 1arc A: [25767]
   complexed with tck

Details for d1arca_

PDB Entry: 1arc, 2 Å

PDB Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease

PDB Compounds: (A:) achromobacter protease I

SCOP Domain Sequences for d1arca_:

Sequence; same for both SEQRES and ATOM records:

>d1arca_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds

Timeline for d1arca_:

• d1arca_ first appeared (with stable ids) in SCOP 1.55, called d1arc__
  
• d1arca_ was called d1arc__ in SCOP 1.71
  
• d1arca_ appears in SCOP 1.75
  
• d1arca_ appears in the current release, SCOPe 2.08