Lineage for d1arc__ (1arc -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins) Protein Achromobacter protease [50496] (1 species) Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (2 PDB entries) 
Domain d1arc__: 1arc - [25767]
Details for d1arc__
PDB Entry: 1arc (more details), 2 Å
PDB Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
SCOP Domain Sequences for d1arc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1arc__ b.47.1.1 (-) Achromobacter protease {Achromobacter lyticus, strain m497-1}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds
SCOP Domain Coordinates for d1arc__:
Click to download the PDB-style file with coordinates for d1arc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1arc__:
- d1arc__ appears in SCOP 1.57
- d1arc__ appears in the current release, SCOPe 2.08, called d1arca_
View in 3D