SCOP 1.71: Domain d1arc__: 1arc -

Lineage for d1arc__ (1arc -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins)

6. Protein Achromobacter protease [50496] (1 species)

7. Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (2 PDB entries)

8. Domain d1arc__: 1arc - [25767]
   complexed with tck

Details for d1arc__

PDB Entry: 1arc, 2 Å

PDB Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease

SCOP Domain Sequences for d1arc__:

Sequence; same for both SEQRES and ATOM records:

>d1arc__ b.47.1.1 (-) Achromobacter protease {Achromobacter lyticus, strain m497-1}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds

Timeline for d1arc__:

• d1arc__ first appeared (with stable ids) in SCOP 1.55
  
• d1arc__ appears in SCOP 1.69
  
• d1arc__ is called d1arca_ in SCOP 1.73
  
• d1arc__ appears in the current release, SCOPe 2.08, called d1arca_