SCOPe 2.07: Domain d4qd2c1: 4qd2 C:9-151

Lineage for d4qd2c1 (4qd2 C:9-151)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:441771] [257654] (1 PDB entry)

8. Domain d4qd2c1: 4qd2 C:9-151 [257657]
   Other proteins in same PDB: d4qd2c2, d4qd2d3, d4qd2e1, d4qd2e2, d4qd2h3, d4qd2i3, d4qd2j1, d4qd2j2
   automated match to d4lo0a1
   complexed with ca

Details for d4qd2c1

PDB Entry: 4qd2, 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex

PDB Compounds: (C:) Hemagglutinin component HA33

SCOPe Domain Sequences for d4qd2c1:

Sequence; same for both SEQRES and ATOM records:

>d4qd2c1 b.42.2.0 (C:9-151) automated matches {Clostridium botulinum [TaxId: 441771]}
nslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihn
tnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnsnyikfiiedyiisdln

Timeline for d4qd2c1:

• d4qd2c1 first appeared in SCOPe 2.04
  
• d4qd2c1 appears in SCOPe 2.06
  
• d4qd2c1 appears in the current release, SCOPe 2.08