Lineage for d4q7ga_ (4q7g A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251912Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2251913Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2251914Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 2251979Protein automated matches [190904] (3 species)
    not a true protein
  7. 2252033Species Staphylococcus aureus [TaxId:282459] [257627] (1 PDB entry)
  8. 2252034Domain d4q7ga_: 4q7g A: [257628]
    automated match to d1pvla_
    complexed with btb

Details for d4q7ga_

PDB Entry: 4q7g (more details), 1.7 Å

PDB Description: 1.7 angstrom crystal structure of leukotoxin lukd from staphylococcus aureus.
PDB Compounds: (A:) Leucotoxin LukDv

SCOPe Domain Sequences for d4q7ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7ga_ f.6.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 282459]}
aqhitpvsekkvddkitlykttatsdndklnisqiltfnfikdksydkdtlvlkaagnin
sgykkpnpkdynysqfywggkynvsvssesndavnvvdyapknqneefqvqqtlgysygg
dinisnglsgglngsksfsetinykqesyrttidrktnhksigwgveahkimnngwgpyg
rdsydptygnelflggrqsssnagqnflpthqmpllargnfnpefisvlshkqndtkksk
ikvtyqremdrytnqwnrlhwvgnnyknqntvtftstyevdwqnhtvkligtdsketnpg

SCOPe Domain Coordinates for d4q7ga_:

Click to download the PDB-style file with coordinates for d4q7ga_.
(The format of our PDB-style files is described here.)

Timeline for d4q7ga_: