Lineage for d4pucb_ (4puc B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007546Family a.118.8.6: SusD-like [158775] (4 protein domains)
    TPR-like structure resides in the N-terminal part; the C-terminal part is structurally unique and is covered by Pfam PF07980
  6. 2007567Protein automated matches [257551] (1 species)
    not a true protein
  7. 2007568Species Bacteroides uniformis [TaxId:411479] [257552] (1 PDB entry)
  8. 2007570Domain d4pucb_: 4puc B: [257554]
    automated match to d3cgha1
    complexed with act, zn

Details for d4pucb_

PDB Entry: 4puc (more details), 2 Å

PDB Description: crystal structure of a susd homolog (bacuni_02643) from bacteroides uniformis atcc 8492 at 2.00 a resolution
PDB Compounds: (B:) SusD homolog

SCOPe Domain Sequences for d4pucb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pucb_ a.118.8.6 (B:) automated matches {Bacteroides uniformis [TaxId: 411479]}
dltpddyalgsamsnlastvissdvntaqftdcllggplggyfadsnagwsntisnfnat
ndwtrvflisdriistlygnlstvkqvsentnnpvpyaiaqiikvaamsrvtdaygpipy
skigqdgkitipydtqeevynaffkeldesievltenrnaalvasadfvysgnvqkwvkf
anslklrlairianvspakakemaesavnhelglietnadnatwkyfgtisnplfvavry
neeasggdthpaadiicymngyndnrrasyfeeskwpgetyvglrrginlskmkeyfiny
srvkisssdpvlwmnaaevaflraeataiygfnmkgtaadfyeqgvrlsfeqwgatgvds
yladessvpalykdpaglntyeknlsaitvkwnegaskeekqeriitqkwianwplgnea
wadyrrtgypkllpatsegnlsggivdsekgarrmpypseeytsntenvqeavnsylggp
dnmatdvwwark

SCOPe Domain Coordinates for d4pucb_:

Click to download the PDB-style file with coordinates for d4pucb_.
(The format of our PDB-style files is described here.)

Timeline for d4pucb_: