![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
![]() | Protein automated matches [254493] (6 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (5 PDB entries) |
![]() | Domain d4po0a3: 4po0 A:389-584 [257520] automated match to d4l8ua3 complexed with nps |
PDB Entry: 4po0 (more details), 2.73 Å
SCOPe Domain Sequences for d4po0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4po0a3 a.126.1.0 (A:389-584) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} kqncelyeqlgdynfqnallvrytkkvpqvstptlveisrslgkvgskcckhpeaerlpc vedylsvvlnrlcvlhektpvsekvtkccseslvdrrpcfsalgpdetyvpkefnaetft fhadictlpeterkikkqtalvelvkhkphatndqlktvvgeftalldkccsaedkeacf avegpklvesskatlg
Timeline for d4po0a3: