SCOPe 2.07: Domain d4po0a3: 4po0 A:389-584

Lineage for d4po0a3 (4po0 A:389-584)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (5 PDB entries)

8. Domain d4po0a3: 4po0 A:389-584 [257520]
   automated match to d4l8ua3
   complexed with nps

Details for d4po0a3

PDB Entry: 4po0, 2.73 Å

PDB Description: Crystal Structure of Leporine Serum Albumin in complex with naproxen

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4po0a3:

Sequence; same for both SEQRES and ATOM records:

>d4po0a3 a.126.1.0 (A:389-584) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
kqncelyeqlgdynfqnallvrytkkvpqvstptlveisrslgkvgskcckhpeaerlpc
vedylsvvlnrlcvlhektpvsekvtkccseslvdrrpcfsalgpdetyvpkefnaetft
fhadictlpeterkikkqtalvelvkhkphatndqlktvvgeftalldkccsaedkeacf
avegpklvesskatlg

Timeline for d4po0a3:

• d4po0a3 first appeared in SCOPe 2.04
  
• d4po0a3 appears in SCOPe 2.06
  
• d4po0a3 appears in the current release, SCOPe 2.08