| Class b: All beta proteins [48724] (176 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
| Protein automated matches [226946] (16 species) not a true protein |
| Species Escherichia coli [TaxId:469008] [257409] (1 PDB entry) |
| Domain d4p3ya2: 4p3y A:206-297 [257410] Other proteins in same PDB: d4p3ya1, d4p3ya3, d4p3yb_ automated match to d1efca1 complexed with gdp, gol, mg |
PDB Entry: 4p3y (more details), 2.15 Å
SCOPe Domain Sequences for d4p3ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3ya2 b.43.3.0 (A:206-297) automated matches {Escherichia coli [TaxId: 469008]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg
Timeline for d4p3ya2: