Lineage for d4p3ya2 (4p3y A:206-297)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544344Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1544345Protein automated matches [226946] (16 species)
    not a true protein
  7. 1544378Species Escherichia coli [TaxId:469008] [257409] (1 PDB entry)
  8. 1544379Domain d4p3ya2: 4p3y A:206-297 [257410]
    Other proteins in same PDB: d4p3ya1, d4p3ya3, d4p3yb_
    automated match to d1efca1
    complexed with gdp, gol, mg

Details for d4p3ya2

PDB Entry: 4p3y (more details), 2.15 Å

PDB Description: crystal structure of acinetobacter baumannii dsba in complex with ef- tu
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4p3ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3ya2 b.43.3.0 (A:206-297) automated matches {Escherichia coli [TaxId: 469008]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d4p3ya2:

Click to download the PDB-style file with coordinates for d4p3ya2.
(The format of our PDB-style files is described here.)

Timeline for d4p3ya2:

View in 3D
Domains from other chains:
(mouse over for more information)
d4p3yb_