Lineage for d4p3ya2 (4p3y A:206-297)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793352Species Escherichia coli [TaxId:469008] [257409] (2 PDB entries)
  8. 2793353Domain d4p3ya2: 4p3y A:206-297 [257410]
    Other proteins in same PDB: d4p3ya1, d4p3ya3, d4p3yb1, d4p3yb2
    automated match to d1efca1
    complexed with gdp, gol, mg

Details for d4p3ya2

PDB Entry: 4p3y (more details), 2.15 Å

PDB Description: crystal structure of acinetobacter baumannii dsba in complex with ef- tu
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4p3ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3ya2 b.43.3.0 (A:206-297) automated matches {Escherichia coli [TaxId: 469008]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d4p3ya2:

Click to download the PDB-style file with coordinates for d4p3ya2.
(The format of our PDB-style files is described here.)

Timeline for d4p3ya2: