Lineage for d4ozfg1 (4ozf G:2-129)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512963Domain d4ozfg1: 4ozf G:2-129 [257358]
    Other proteins in same PDB: d4ozfa1, d4ozfa2, d4ozfb1, d4ozfb2, d4ozfg2, d4ozfh1, d4ozfh2
    automated match to d2esvd1
    complexed with nag

Details for d4ozfg1

PDB Entry: 4ozf (more details), 2.7 Å

PDB Description: jr5.1 protein complex
PDB Compounds: (G:) T-cell receptor, jr5.1 alpha chain

SCOPe Domain Sequences for d4ozfg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozfg1 b.1.1.1 (G:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
liitedrksstlilphatlrdtavyyciafqgaqklvfgqgtrltinpn

SCOPe Domain Coordinates for d4ozfg1:

Click to download the PDB-style file with coordinates for d4ozfg1.
(The format of our PDB-style files is described here.)

Timeline for d4ozfg1: