Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries) |
Domain d4ozfg1: 4ozf G:2-129 [257358] Other proteins in same PDB: d4ozfa1, d4ozfa2, d4ozfb1, d4ozfb2, d4ozfg2, d4ozfh1, d4ozfh2 automated match to d2esvd1 complexed with nag |
PDB Entry: 4ozf (more details), 2.7 Å
SCOPe Domain Sequences for d4ozfg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozfg1 b.1.1.1 (G:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas liitedrksstlilphatlrdtavyyciafqgaqklvfgqgtrltinpn
Timeline for d4ozfg1: