Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries) |
Domain d4ozfb1: 4ozf B:3-92 [257362] Other proteins in same PDB: d4ozfa2, d4ozfb2, d4ozfg1, d4ozfg2, d4ozfh1, d4ozfh2 automated match to d1klub2 complexed with nag |
PDB Entry: 4ozf (more details), 2.7 Å
SCOPe Domain Sequences for d4ozfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozfb1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn sqkdilerkraavdrvcrhnyqlelrttlq
Timeline for d4ozfb1: