![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
![]() | Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries) |
![]() | Domain d1tuib2: 1tui B:313-405 [25734] Other proteins in same PDB: d1tuia1, d1tuia3, d1tuib1, d1tuib3, d1tuic1, d1tuic3 |
PDB Entry: 1tui (more details), 2.7 Å
SCOP Domain Sequences for d1tuib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuib2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus} htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1tuib2: