![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
![]() | Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries) |
![]() | Domain d1b23p2: 1b23 P:313-405 [25729] Other proteins in same PDB: d1b23p1, d1b23p3 protein/RNA complex; complexed with cys, gnp, mg, so4 |
PDB Entry: 1b23 (more details), 2.6 Å
SCOPe Domain Sequences for d1b23p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b23p2 b.44.1.1 (P:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]} htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1b23p2: