Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (11 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries) |
Domain d1b23p1: 1b23 P:213-312 [25689] Other proteins in same PDB: d1b23p2, d1b23p3 protein/RNA complex; complexed with cys, gnp, mg, so4 |
PDB Entry: 1b23 (more details), 2.6 Å
SCOPe Domain Sequences for d1b23p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b23p1 b.43.3.1 (P:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvglllrgvsreevergqvlakpgsitp
Timeline for d1b23p1: