Lineage for d1b23p2 (1b23 P:313-405)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily) Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) 
Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins) 
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) 
Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries) 
Domain d1b23p2: 1b23 P:313-405 [25729]
Other proteins in same PDB: d1b23p1, d1b23p3
Details for d1b23p2
PDB Entry: 1b23 (more details), 2.6 Å
PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex
SCOP Domain Sequences for d1b23p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b23p2 b.44.1.1 (P:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile
SCOP Domain Coordinates for d1b23p2:
Click to download the PDB-style file with coordinates for d1b23p2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b23p2:
- d1b23p2 first appeared (with stable ids) in SCOP 1.55
- d1b23p2 appears in SCOP 1.57
- d1b23p2 appears in SCOP 1.61
- d1b23p2 appears in the current release, SCOPe 2.08
View in 3D
