Lineage for d1b23p3 (1b23 P:1-212)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.8: G proteins [52592] (23 proteins) 
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) 
Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) 
Domain d1b23p3: 1b23 P:1-212 [32124]
Other proteins in same PDB: d1b23p1, d1b23p2
Details for d1b23p3
PDB Entry: 1b23 (more details), 2.6 Å
PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex
SCOP Domain Sequences for d1b23p3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b23p3 c.37.1.8 (P:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt
SCOP Domain Coordinates for d1b23p3:
Click to download the PDB-style file with coordinates for d1b23p3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b23p3:
- d1b23p3 first appeared (with stable ids) in SCOP 1.55
- d1b23p3 appears in SCOP 1.57
- d1b23p3 appears in SCOP 1.61
- d1b23p3 appears in the current release, SCOPe 2.08
View in 3D
