| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) ![]() |
| Family a.177.1.0: automated matches [254327] (1 protein) not a true family |
| Protein automated matches [254748] (2 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [257266] (1 PDB entry) |
| Domain d4oiof1: 4oio F:78-257 [257267] Other proteins in same PDB: d4oioc_, d4oiod_, d4oioe_, d4oiof2, d4oiof3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn |
PDB Entry: 4oio (more details), 3.1 Å
SCOPe Domain Sequences for d4oiof1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oiof1 a.177.1.0 (F:78-257) automated matches {Thermus thermophilus [TaxId: 300852]}
sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg
sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
Timeline for d4oiof1: