Lineage for d4oiof1 (4oio F:78-257)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752715Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 1752716Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 1752769Family a.177.1.0: automated matches [254327] (1 protein)
    not a true family
  6. 1752770Protein automated matches [254748] (2 species)
    not a true protein
  7. 1752776Species Thermus thermophilus [TaxId:300852] [257266] (1 PDB entry)
  8. 1752777Domain d4oiof1: 4oio F:78-257 [257267]
    Other proteins in same PDB: d4oioc_, d4oiod_, d4oioe_, d4oiof2, d4oiof3
    automated match to d1smyf3
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4oiof1

PDB Entry: 4oio (more details), 3.1 Å

PDB Description: Crystal structure of Thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
PDB Compounds: (F:) DNA directed RNA polymerase sigma factor A

SCOPe Domain Sequences for d4oiof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oiof1 a.177.1.0 (F:78-257) automated matches {Thermus thermophilus [TaxId: 300852]}
sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg
sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart

SCOPe Domain Coordinates for d4oiof1:

Click to download the PDB-style file with coordinates for d4oiof1.
(The format of our PDB-style files is described here.)

Timeline for d4oiof1: