SCOPe 2.08: Domain d4oiof1: 4oio F:78-257

Lineage for d4oiof1 (4oio F:78-257)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
   multihelical; consists of a conserved 4-helical core and a variable insert subdomain

4. Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families)

5. Family a.177.1.0: automated matches [254327] (1 protein)
   not a true family

6. Protein automated matches [254748] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [257266] (1 PDB entry)

8. Domain d4oiof1: 4oio F:78-257 [257267]
   Other proteins in same PDB: d4oioc_, d4oiod_, d4oioe_, d4oiof2, d4oiof3
   automated match to d1smyf3
   protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4oiof1

PDB Entry: 4oio, 3.1 Å

PDB Description: Crystal structure of Thermus thermophilus pre-insertion substrate complex for de novo transcription initiation

PDB Compounds: (F:) DNA directed RNA polymerase sigma factor A

SCOPe Domain Sequences for d4oiof1:

Sequence; same for both SEQRES and ATOM records:

>d4oiof1 a.177.1.0 (F:78-257) automated matches {Thermus thermophilus [TaxId: 300852]}
sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg
sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart

Timeline for d4oiof1:

• d4oiof1 first appeared in SCOPe 2.04
  
• d4oiof1 appears in SCOPe 2.07