Lineage for d1d8ta2 (1d8t A:297-393)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063485Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063486Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2063487Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2063515Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 2063522Species Escherichia coli [TaxId:562] [50468] (8 PDB entries)
    Uniprot P02990
  8. 2063527Domain d1d8ta2: 1d8t A:297-393 [25726]
    Other proteins in same PDB: d1d8ta1, d1d8ta3, d1d8tb1, d1d8tb3
    complexed with act, gdp, mg

Details for d1d8ta2

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1d8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ta2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d1d8ta2:

Click to download the PDB-style file with coordinates for d1d8ta2.
(The format of our PDB-style files is described here.)

Timeline for d1d8ta2: