Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein automated matches [190209] (7 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:82834] [257201] (1 PDB entry) |
Domain d4nyfb_: 4nyf B: [257202] automated match to d3vq9c_ complexed with 4bi, cd |
PDB Entry: 4nyf (more details), 1.9 Å
SCOPe Domain Sequences for d4nyfb_:
Sequence, based on SEQRES records: (download)
>d4nyfb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus type 1 [TaxId: 82834]} sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht dngsnftsatvkaacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta vqmavfihnkkrkggiggysagerivdiiatd
>d4nyfb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus type 1 [TaxId: 82834]} sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht dngsnftsatvkaacdwagikqedgipynpesmnkelkkiigqvrdqaehlktavqmavf ihnkkrysagerivdiiatd
Timeline for d4nyfb_: