Lineage for d4nyfb_ (4nyf B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606866Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1606980Protein automated matches [190209] (7 species)
    not a true protein
  7. 1607112Species Human immunodeficiency virus type 1 [TaxId:82834] [257201] (1 PDB entry)
  8. 1607113Domain d4nyfb_: 4nyf B: [257202]
    automated match to d3vq9c_
    complexed with 4bi, cd

Details for d4nyfb_

PDB Entry: 4nyf (more details), 1.9 Å

PDB Description: HIV integrase in complex with inhibitor
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d4nyfb_:

Sequence, based on SEQRES records: (download)

>d4nyfb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus type 1 [TaxId: 82834]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsatvkaacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatd

Sequence, based on observed residues (ATOM records): (download)

>d4nyfb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus type 1 [TaxId: 82834]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsatvkaacdwagikqedgipynpesmnkelkkiigqvrdqaehlktavqmavf
ihnkkrysagerivdiiatd

SCOPe Domain Coordinates for d4nyfb_:

Click to download the PDB-style file with coordinates for d4nyfb_.
(The format of our PDB-style files is described here.)

Timeline for d4nyfb_: