![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
![]() | Protein Retroviral integrase, catalytic domain [53108] (3 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (42 PDB entries) |
![]() | Domain d3vq9c_: 3vq9 C: [201255] automated match to d3vq9b_ protein/DNA complex; complexed with fbb |
PDB Entry: 3vq9 (more details), 1.9 Å
SCOPe Domain Sequences for d3vq9c_:
Sequence, based on SEQRES records: (download)
>d3vq9c_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa ehlktavqmavfihnhkrkggiggysagerivdiiatdiqt
>d3vq9c_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa ehlktavqmavfihnhkrkggysagerivdiiatdiqt
Timeline for d3vq9c_: