Lineage for d4nida_ (4nid A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404877Family b.82.2.10: AlkB-like [141628] (3 protein domains)
    automatically mapped to Pfam PF13532
  6. 2404894Protein automated matches [191077] (2 species)
    not a true protein
  7. 2404917Species Escherichia coli [TaxId:562] [313153] (4 PDB entries)
  8. 2404920Domain d4nida_: 4nid A: [257161]
    automated match to d3khca_
    protein/DNA complex; protein/RNA complex; complexed with akg, mn

Details for d4nida_

PDB Entry: 4nid (more details), 1.58 Å

PDB Description: Crystal structure of AlkB protein with cofactors bound to dsDNA containing m6A
PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d4nida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nida_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 562]}
qeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtt
hrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclh
qdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqp
lkagfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d4nida_:

Click to download the PDB-style file with coordinates for d4nida_.
(The format of our PDB-style files is described here.)

Timeline for d4nida_: