![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Elongation factor G (EF-G), domain II [50456] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries) |
![]() | Domain d1fnma1: 1fnm A:283-403 [25709] Other proteins in same PDB: d1fnma2, d1fnma3, d1fnma4, d1fnma5 complexed with gdp, mg |
PDB Entry: 1fnm (more details), 2.8 Å
SCOPe Domain Sequences for d1fnma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnma1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi e
Timeline for d1fnma1:
![]() Domains from same chain: (mouse over for more information) d1fnma2, d1fnma3, d1fnma4, d1fnma5 |