PDB entry 1fnm

View 1fnm on RCSB PDB site
Description: structure of thermus thermophilus ef-g h573a
Class: translation
Keywords: Bent conformation, Visible domain III, Mutation His573Ala, TRANSLATION
Deposited on 2000-08-22, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13551
      • engineered (572)
    Domains in SCOPe 2.07: d1fnma1, d1fnma2, d1fnma3, d1fnma4, d1fnma5
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fnmA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyaevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnmA (A:)
    eydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdftie
    versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm
    qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqareyh
    eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll
    davvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysg
    tltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvged
    aprvilesievpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisg
    mgelhleiivdrlkrefkvdanvgkpqvayretitkpvdvegkfirqtggrgqyghvkik
    veplprgsgfefvnaivggvipkeyipavqkgieeamqsgpligfpvvdikvtlydgsya
    evdssemafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvigdlnarrgqilg
    meprgnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqekli