Lineage for d4l8fa_ (4l8f A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2118193Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2118194Protein automated matches [190197] (20 species)
    not a true protein
  7. 2118421Species Zebrafish (Danio rerio) [TaxId:7955] [256984] (5 PDB entries)
  8. 2118422Domain d4l8fa_: 4l8f A: [256986]
    automated match to d1l9xa_
    complexed with mtx

Details for d4l8fa_

PDB Entry: 4l8f (more details), 1.97 Å

PDB Description: Crystal structure of gamma-glutamyl hydrolase (C108A) complex with MTX
PDB Compounds: (A:) gamma-glutamyl hydrolase

SCOPe Domain Sequences for d4l8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l8fa_ c.23.16.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtalgfelltlltsgelll
shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn

SCOPe Domain Coordinates for d4l8fa_:

Click to download the PDB-style file with coordinates for d4l8fa_.
(The format of our PDB-style files is described here.)

Timeline for d4l8fa_: