SCOPe 2.04: Domain d4l8fa_: 4l8f A:

Lineage for d4l8fa_ (4l8f A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (15 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [256984] (3 PDB entries)

8. Domain d4l8fa_: 4l8f A: [256986]
   automated match to d1l9xa_
   complexed with mtx

Details for d4l8fa_

PDB Entry: 4l8f, 1.97 Å

PDB Description: Crystal structure of gamma-glutamyl hydrolase (C108A) complex with MTX

PDB Compounds: (A:) gamma-glutamyl hydrolase

SCOPe Domain Sequences for d4l8fa_:

Sequence; same for both SEQRES and ATOM records:

>d4l8fa_ c.23.16.0 (A:) automated matches {Danio rerio [TaxId: 7955]}
ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtalgfelltlltsgelll
shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn

Timeline for d4l8fa_:

• d4l8fa_ is new in SCOPe 2.04-stable
  
• d4l8fa_ appears in SCOPe 2.05
  
• d4l8fa_ appears in the current release, SCOPe 2.08