Lineage for d1exma1 (1exm A:213-312)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. Species Thermus thermophilus [TaxId:274] [50452] (4 PDB entries)
  8. 1544152Domain d1exma1: 1exm A:213-312 [25696]
    Other proteins in same PDB: d1exma2, d1exma3
    protein/RNA complex; complexed with gnp, mg

Details for d1exma1

PDB Entry: 1exm (more details), 1.7 Å

PDB Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.
PDB Compounds: (A:) elongation factor tu (ef-tu)

SCOPe Domain Sequences for d1exma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exma1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1exma1:

Click to download the PDB-style file with coordinates for d1exma1.
(The format of our PDB-style files is described here.)

Timeline for d1exma1: